unkempt
adjectiveHow many syllables in unkempt?
There are 2 syllables in the word unkempt.Divide unkempt into syllables:
un · kempt
How to pronounce unkempt:
Definition of unkempt:
- unkempt (adjective):
- not combed
- not neatly combed.
- (of the hair) uncombed or dishevelled
Synonyms for unkempt:
muddledrumpledmesseddisheveledwrinkleddirtyuntidymessygrimyclutteredShow 14 more
Other 2-syllable words like unkempt
Here are some other common words that have 2 syllables, like unkempt does.
Syllable Quiz
How many syllables in the word throwed?
Question 1 of 5
Syllable Fun Fact
The Guinness World Record for the longest word by syllables is the chemical name for the protein nicknamed 'titin', with 189,819 letters and thousands of syllables.
You, too, can become a syllable pro and wow your friends, family, and pets!
Trending words
These words are popular right now. Visit each word to master its syllable count.