Syllable CounterHaiku CheckerSyllable DictionaryRulesPoetry
suntanned
noun
See more 2-syllable nouns

Divide suntanned into syllables:

sun · tanned

How to pronounce suntanned:

Definition of suntanned:

suntanned (noun):
a browning of the skin from exposure to the rays of the sun

Synonyms for suntanned:

redsanguinepinkrosyruddybloomingfloridwarmpinkishbronzed

Antonyms for suntanned:

milkyfairwanpastywhitepalesallowcreamysnowypallid

Other 2-syllable words like suntanned

Here are some other common words that have 2 syllables, like suntanned does.

See all 2-syllable words
Syllable Quiz
How many syllables in the word remold?

Question 1 of 5

Syllable Fun Fact
The Guinness World Record for the longest word by syllables is the chemical name for the protein nicknamed 'titin', with 189,819 letters and thousands of syllables.

You, too, can become a syllable pro and wow your friends, family, and pets!

Learn more syllable fun facts
Trending words

These words are popular right now. Visit each word to master its syllable count.

  1. surreptitiously
  2. heaven
  3. seriously
  4. unbeknownst
  5. convenient
  6. colleague
  7. confide
  8. equivocate
  9. infatuated
  10. slovenly


Syllable Counter is reader-supported. When you purchase something through one of our links, we may earn a small commission at no cost to you.

©2025 SyllableCounter.io