suntanned
nounDivide suntanned into syllables:
sun · tanned
How to pronounce suntanned:
Definition of suntanned:
- suntanned (noun):
- a browning of the skin from exposure to the rays of the sun
Synonyms for suntanned:
redsanguinepinkrosyruddybloomingfloridwarmpinkishbronzedAntonyms for suntanned:
milkyfairwanpastywhitepalesallowcreamysnowypallidOther 2-syllable words like suntanned
Here are some other common words that have 2 syllables, like suntanned does.
Syllable Quiz
How many syllables in the word remold?
Question 1 of 5
Syllable Fun Fact
The Guinness World Record for the longest word by syllables is the chemical name for the protein nicknamed 'titin', with 189,819 letters and thousands of syllables.
You, too, can become a syllable pro and wow your friends, family, and pets!
Trending words
These words are popular right now. Visit each word to master its syllable count.