screeched
nounDivide screeched into syllables:
screeched
How to pronounce screeched:
Definition of screeched:
- screeched (noun):
- a high shrill piercing cry usually expressing pain or terror
Synonyms for screeched:
squealhowledshoutedcriedscreamyelpedshriekyelledsquealedscreamedShow 1 more
Antonyms for screeched:
whinedbabbleddronedrambledgarbledgruntedrumbledmurmuredslurredwhisperedShow 5 more
Syllable Quiz
How many syllables in the word rivulet?
Question 1 of 5
Syllable Fun Fact
In non-linear phonology, the syllable is seen not as a linear sequence but as a hierarchical structure of constituents.
You, too, can become a syllable pro and wow your friends, family, and pets!
Trending words
These words are popular right now. Visit each word to master its syllable count.