Syllable CounterHaiku CheckerSyllable DictionaryRulesPoetry
screeched
noun
See more 1-syllable nouns

Divide screeched into syllables:

screeched

How to pronounce screeched:

Definition of screeched:

screeched (noun):
a high shrill piercing cry usually expressing pain or terror

Synonyms for screeched:

squealhowledshoutedcriedscreamyelpedshriekyelledsquealedscreamed
Show 1 more

Antonyms for screeched:

whinedbabbleddronedrambledgarbledgruntedrumbledmurmuredslurredwhispered
Show 5 more

Other 1-syllable words like screeched

Here are some other common words that have 1 syllable, like screeched does.

  • yield
  • speared
  • schlepped
  • wolf
  • reach
  • soul
  • care
  • ceased
  • strolled
  • words
  • peace
  • door
  • hands
  • slips
  • force
  • gasped
  • duped
  • rinsed
  • beamed
  • scoffed
  • gals
  • bad
  • seized
  • done
  • true
  • … more
See all 1-syllable words
Syllable Quiz
How many syllables in the word rivulet?

Question 1 of 5

Syllable Fun Fact
In non-linear phonology, the syllable is seen not as a linear sequence but as a hierarchical structure of constituents.

You, too, can become a syllable pro and wow your friends, family, and pets!

Learn more syllable fun facts
Trending words

These words are popular right now. Visit each word to master its syllable count.

  1. surreptitiously
  2. heaven
  3. seriously
  4. unbeknownst
  5. convenient
  6. colleague
  7. confide
  8. equivocate
  9. infatuated
  10. slovenly


Syllable Counter is reader-supported. When you purchase something through one of our links, we may earn a small commission at no cost to you.

©2025 SyllableCounter.io