Syllable CounterHaiku CheckerSyllable DictionaryRulesPoetry
frighteningly
verb
See more 4-syllable verbs

How to pronounce frighteningly:

Definition of frighteningly:

frighteningly (verb):
to make afraid terrify

Synonyms for frighteningly:

startlehorrifyshaketerrifydistractpanicshockaffrightterrorizefright
Show 3 more

Antonyms for frighteningly:

peacefullycompassionatelykindlycaringlywarmlyhelpfullyunderstandinglyprotectivelytenderlylovingly
Show 4 more

Other 4-syllable words like frighteningly

Here are some other common words that have 4 syllables, like frighteningly does.

See all 4-syllable words
Syllable Quiz
How many syllables in the word exigent?

Question 1 of 5

Syllable Fun Fact
The Guinness World Record for the longest word by syllables is the chemical name for the protein nicknamed 'titin', with 189,819 letters and thousands of syllables.

You, too, can become a syllable pro and wow your friends, family, and pets!

Learn more syllable fun facts
Trending words

These words are popular right now. Visit each word to master its syllable count.

  1. surreptitiously
  2. heaven
  3. seriously
  4. unbeknownst
  5. convenient
  6. colleague
  7. confide
  8. equivocate
  9. infatuated
  10. slovenly


Syllable Counter is reader-supported. When you purchase something through one of our links, we may earn a small commission at no cost to you.

©2025 SyllableCounter.io