frighteningly
verbHow to pronounce frighteningly:
Definition of frighteningly:
- frighteningly (verb):
- to make afraid terrify
Synonyms for frighteningly:
startlehorrifyshaketerrifydistractpanicshockaffrightterrorizefrightShow 3 more
Antonyms for frighteningly:
peacefullycompassionatelykindlycaringlywarmlyhelpfullyunderstandinglyprotectivelytenderlylovinglyShow 4 more
Other 4-syllable words like frighteningly
Here are some other common words that have 4 syllables, like frighteningly does.
Syllable Quiz
How many syllables in the word exigent?
Question 1 of 5
Syllable Fun Fact
The Guinness World Record for the longest word by syllables is the chemical name for the protein nicknamed 'titin', with 189,819 letters and thousands of syllables.
You, too, can become a syllable pro and wow your friends, family, and pets!
Trending words
These words are popular right now. Visit each word to master its syllable count.